The KNOTTIN database

Pre-compiled sequence alignments

Access: 81395
Comments:
Below are manually checked pre-compiled alignments.
For more flexibility, please use the Search Database button in the left menu.

Agouti-related

Alpha-amylase inhibitor

Algae

Bacteria

Bug

Ciliate

Conotoxin1

Conotoxin2

Conotoxin3

Cyclotide

Fungi1

Fungi2

Gurmarin-like

Horseshoe crab

Insect1

Insect2

Maize

Metallocarboxypeptidase inhibitor

Mycetozoa

Plant antimicrobial

Plant defensin

Plant toxin

Plant toxin2

Scorpion1

Scorpion2

Serine protease inhibitor1

Serine protease inhibitor2

Serine protease inhibitor3

Spider

Sponge

Trematoda

Trichoplax

Virus1

Virus2

Water flea

Water flea
To get text formatted data use the drop-down menu
#=Position                     ----+---10----+---20----+---30----+---40----+---50----+---60----+---70
UniRef100_E9FSX5               MTNEQQSAGLNYFTDNAEPLMENAQKRSCIRRGGSCDHRRNDCCFSSSCRCNLWGSNCRCHRAGLFQKWG